HORDB

ID: hor006654
Uniprot ID: Q18234
Protein name: Fmrf-like peptide protein 21
Gene name: flp-21
Organism: Caenorhabditis elegans
Family: FARP (FMRFamide related peptide) family
Source: animal
Expression: Expressed in the ADL, ASE and ASH sensory neurons, the URA motor neurons and the MC, M2 and M4 pharyngeal neurons.
Disease: NA
Comments: NA
Taxonomy: Caenorhabditis (genus), Peloderinae (subfamily), Rhabditidae (family), Rhabditoidea (superfamily), Rhabditomorpha (infraorder), Rhabditina (suborder), Rhabditida (order), Chromadorea (class), Nematoda (phylum), Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0031841 neuropeptide Y receptor binding
GO BP: GO:0007218 neuropeptide signaling pathway; GO:0007631 feeding behavior; GO:0030431 sleep
GO CC: GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence: MRLFILLSCLLAWVLAAPYIDQEDALRVLNAYLEQFGPGSDRVYYVAEDDHGSMKRGLGPRPLRFG
Length: 66
Propeptide: MRLFILLSCLLAWVLAAPYIDQEDALRVLNAYLEQFGPGSDRVYYVAEDDHGSMKRGLGPRPLRFG
Signal peptide: MRLFILLSCLLAWVLA
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Function: FMRFamide-like neuropeptide (PubMed:12821653, PubMed:14555955). Involved in modulating locomotion quiescence during the sleep-like state called lethargus which occurs during molting between larval and adult stages, acting via the G-protein coupled receptor npr-1 (PubMed:23764289). Plays a role in modulating social and feeding behavior (PubMed:14555955).
Mechanism: NA
Cross BBB: NA
Target: npr-5
Target Unid: Q6F3C9
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

AF-Q18234-F1.pdb

hor006654_AF2.pdb

hor006654_ESM.pdb

Mass:	864528	Formula:	C341H527N91O93S3
Absent amino acids:	T	Common amino acids:	L
pI:	5.73	Basic residues:	8
Polar residues:	15	Hydrophobic residues:	27
Hydrophobicity:	4.85	Boman Index:	-7837
Half-Life:	30 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	103.48
Instability Index:	4092.27	Extinction Coefficient cystines:	11460
Absorbance 280nm:	176.31

PubMed ID: 9851916
Title: Genome sequence of the nematode C. elegans: a platform for investigating biology.
PubMed ID: 12821653
Title: Differential activation of "social" and "solitary" variants of the Caenorhabditis elegans G protein-coupled receptor NPR-1 by its cognate ligand AF9.
PubMed ID: 14555955
Title: Inhibition of Caenorhabditis elegans social feeding by FMRFamide-related peptide activation of NPR-1.
PubMed ID: 23764289
Title: Analysis of NPR-1 reveals a circuit mechanism for behavioral quiescence in C. elegans.
PubMed ID: 25804345
Title: The laboratory domestication of Caenorhabditis elegans.
PubMed ID: 30229400
Title: Deciphering the Role of EGL-3 for Neuropeptides Processing in Caenorhabditis elegans Using High-Resolution Quadrupole-Orbitrap Mass Spectrometry.